PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G087741_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TALE
Protein Properties Length: 295aa    MW: 32493.5 Da    PI: 5.6022
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G087741_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092292622255
                        SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  GRMZM2G087741_P01 229 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 262
                        69*****************************885 PP

2ELK33.21.1e-11182203122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELK++Ll+KYsg+L+ L++EF+
  GRMZM2G087741_P01 182 ELKEMLLKKYSGCLSRLRSEFL 203
                        9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.9E-193983IPR005540KNOX1
PfamPF037901.3E-174181IPR005540KNOX1
SMARTSM012565.3E-2786137IPR005541KNOX2
PfamPF037911.5E-2390136IPR005541KNOX2
PROSITE profilePS5121310.423182202IPR005539ELK domain
SMARTSM011883.6E-6182203IPR005539ELK domain
PfamPF037891.3E-8182203IPR005539ELK domain
PROSITE profilePS5007112.633202265IPR001356Homeobox domain
SMARTSM003894.4E-14204269IPR001356Homeobox domain
SuperFamilySSF466898.55E-20204273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-27207267IPR009057Homeodomain-like
CDDcd000863.19E-13214266No hitNo description
PfamPF059204.8E-17222261IPR008422Homeobox KN domain
PROSITE patternPS000270240263IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MEDLYSIHPG ISRVVGGAAS EASVAGAGAG GPSPSDLTEL MKAQIASHPR YPSLLSAYIE  60
CRKVGAHPHV TSLLEEVSRE RRPDAGAGEI GVDPELDEFM DAYCRVLVRY KEELTRPFDE  120
AASFLSSIQA QLSDLCSGGS SPAATATHSD DMMGSSEDEQ CSGDTDVPDM GQEHSSHLGD  180
HELKEMLLKK YSGCLSRLRS EFLKKRKKGK LPKDARTVLL EWWNTHYRWP YPTEEDKVRL  240
AAMTGLDPKQ INNWFINQRK RHWKPSEDMR FALMEGVAGG SSGTTLYFDT GTIGP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197206LRSEFLKKRK
2203207KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.4360.0ear| meristem| root| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G087741
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G087741_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1004550.0AF100455.1 Zea mays knotted class 1 homeodomain protein liguleless3 (lg3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105508.10.0liguleless 3
SwissprotQ9FP291e-161KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLF1DJR20.0F1DJR2_MAIZE; Homeobox HB transcription factor CDS (Fragment)
TrEMBLQ9SYT60.0Q9SYT6_MAIZE; Knotted class 1 homeodomain protein liguleless3
STRINGGRMZM2G087741_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-81KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Kaplinsky NJ,Braun DM,Penterman J,Goff SA,Freeling M
    Utility and distribution of conserved noncoding sequences in the grasses.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(9): p. 6147-51
    [PMID:11972021]
  2. Bauer P, et al.
    Regulation and a conserved intron sequence of liguleless3/4 knox class-I homeobox genes in grasses.
    Planta, 2004. 219(2): p. 359-68
    [PMID:15034715]
  3. Muehlbauer GJ, et al.
    Ectopic expression of the maize homeobox gene liguleless3 alters cell fates in the leaf.
    Plant Physiol., 1999. 119(2): p. 651-62
    [PMID:9952462]